Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein Dihydropteroate synthetase [51719] (5 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (34 PDB entries) Uniprot Q81VW8 |
Domain d3h2ab1: 3h2a B:1-274 [232359] Other proteins in same PDB: d3h2ab2 automated match to d3h2cb_ complexed with b57, so4 |
PDB Entry: 3h2a (more details), 2.4 Å
SCOPe Domain Sequences for d3h2ab1:
Sequence, based on SEQRES records: (download)
>d3h2ab1 c.1.21.1 (B:1-274) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mkwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahii diggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiin diwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrden iildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtga tvclgiekgcefvrvhdvkemsrmakmmdamigk
>d3h2ab1 c.1.21.1 (B:1-274) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mkwdydlrcgeytlnlnektlimgilnvtpggsynevdaavrhakemrdegahiidigge stvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepki aevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfak tpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgce fvrvhdvkemsrmakmmdamigk
Timeline for d3h2ab1: