Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (8 species) not a true protein |
Species Comamonas testosteroni [TaxId:285] [232352] (1 PDB entry) |
Domain d3gzxa1: 3gzx A:18-178 [232353] Other proteins in same PDB: d3gzxa2, d3gzxb_ automated match to d1o7na1 complexed with bnl, fe2, fes, gol, mes |
PDB Entry: 3gzx (more details), 1.58 Å
SCOPe Domain Sequences for d3gzxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gzxa1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]} nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp
Timeline for d3gzxa1: