SCOPe 2.03: Domain d3gzxa1: 3gzx A:18-178

Lineage for d3gzxa1 (3gzx A:18-178)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (8 species)
   not a true protein

7. Species Comamonas testosteroni [TaxId:285] [232352] (1 PDB entry)

8. Domain d3gzxa1: 3gzx A:18-178 [232353]
   Other proteins in same PDB: d3gzxa2, d3gzxb_
   automated match to d1o7na1
   complexed with bnl, fe2, fes, gol, mes

Details for d3gzxa1

PDB Entry: 3gzx, 1.58 Å

PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356

PDB Compounds: (A:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d3gzxa1:

Sequence; same for both SEQRES and ATOM records:

>d3gzxa1 b.33.1.0 (A:18-178) automated matches {Comamonas testosteroni [TaxId: 285]}
nwtpdairalvdqdngkldariyadqdlyqlelervfgrswlmlghethipkigdyltty
mgedpvimvrqkdqsikvflnqcrhrgmrivrsdggnakaftctyhgwaydiagnlvnvp
fekeafcdkkegdcgfdkadwgplqarvetykglvfanwdp

Timeline for d3gzxa1:

• d3gzxa1 is new in SCOPe 2.03-stable
  
• d3gzxa1 appears in SCOPe 2.04
  
• d3gzxa1 appears in the current release, SCOPe 2.08