Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries) |
Domain d3gymb_: 3gym B: [232351] Other proteins in same PDB: d3gymi_, d3gymj_ automated match to d3gylb_ |
PDB Entry: 3gym (more details), 2.8 Å
SCOPe Domain Sequences for d3gymb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gymb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk v
Timeline for d3gymb_: