Lineage for d3gymb_ (3gym B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2066947Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries)
  8. 2067007Domain d3gymb_: 3gym B: [232351]
    Other proteins in same PDB: d3gymi_, d3gymj_
    automated match to d3gylb_

Details for d3gymb_

PDB Entry: 3gym (more details), 2.8 Å

PDB Description: structure of prostasin in complex with aprotinin
PDB Compounds: (B:) Prostasin

SCOPe Domain Sequences for d3gymb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gymb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itggssavagqwpwqvsityegvhvcggslvseqwvlsaahcfpsehhkeayevklgahq
ldsysedakvstlkdiiphpsylqegsqgdiallqlsrpitfsryirpislpaaqasfpn
glhctvtgwghvapsvslltpkplqqlevplisretcnslynidakpeephfvqedmvca
gyveggkdacqgdsggplscpveglwyltgivswgdacgarnrpgvytlassyaswiqsk
v

SCOPe Domain Coordinates for d3gymb_:

Click to download the PDB-style file with coordinates for d3gymb_.
(The format of our PDB-style files is described here.)

Timeline for d3gymb_: