SCOPe 2.08: Domain d3gx0a2: 3gx0 A:86-204

Lineage for d3gx0a2 (3gx0 A:86-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [232348] (2 PDB entries)

8. Domain d3gx0a2: 3gx0 A:86-204 [232349]
   Other proteins in same PDB: d3gx0a1
   automated match to d4ecib2
   complexed with gds

Details for d3gx0a2

PDB Entry: 3gx0, 2.3 Å

PDB Description: Crystal Structure of GSH-dependent Disulfide bond Oxidoreductase

PDB Compounds: (A:) GST-like protein yfcG

SCOPe Domain Sequences for d3gx0a2:

Sequence; same for both SEQRES and ATOM records:

>d3gx0a2 a.45.1.0 (A:86-204) automated matches {Escherichia coli K-12 [TaxId: 83333]}
flshetreraatlqwlfwqvgglgpmlgqnhhfnhaapqtipyaieryqvetqrlyhvln
krlenspwlggenysiadiacwpwvnawtrqridlamypavknwherirsrpatgqall

Timeline for d3gx0a2:

• d3gx0a2 first appeared in SCOPe 2.03
  
• d3gx0a2 appears in SCOPe 2.07