SCOPe 2.07: Domain d3gx0a1: 3gx0 A:1-85

Lineage for d3gx0a1 (3gx0 A:1-85)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [232346] (2 PDB entries)

8. Domain d3gx0a1: 3gx0 A:1-85 [232347]
   Other proteins in same PDB: d3gx0a2
   automated match to d4ecib1
   complexed with gds

Details for d3gx0a1

PDB Entry: 3gx0, 2.3 Å

PDB Description: Crystal Structure of GSH-dependent Disulfide bond Oxidoreductase

PDB Compounds: (A:) GST-like protein yfcG

SCOPe Domain Sequences for d3gx0a1:

Sequence; same for both SEQRES and ATOM records:

>d3gx0a1 c.47.1.0 (A:1-85) automated matches {Escherichia coli K-12 [TaxId: 83333]}
midlyfaptpnghkitlfleeaeldyrlikvdlgkggqfrpeflrispnnkipaivdhsp
adggeplslfesgaillylaektgl

Timeline for d3gx0a1:

• d3gx0a1 first appeared in SCOPe 2.03
  
• d3gx0a1 appears in SCOPe 2.06
  
• d3gx0a1 appears in the current release, SCOPe 2.08