Lineage for d3gwma_ (3gwm A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676137Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1676138Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1676171Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1676172Protein automated matches [191061] (8 species)
    not a true protein
  7. 1676200Species Mycobacterium smegmatis [TaxId:246196] [232344] (1 PDB entry)
  8. 1676201Domain d3gwma_: 3gwm A: [232345]
    automated match to d3nfde_
    complexed with so4

Details for d3gwma_

PDB Entry: 3gwm (more details), 1.7 Å

PDB Description: crystal structure of the holo-[acyl-carrier-protein] synthase (acps) from mycobacterium smegmatis
PDB Compounds: (A:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3gwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gwma_ d.150.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
aivgvgidlvsipdfaeqvdrpgtvfaetftpgerrdaadksssaarhlaarwaakeavi
kawsssrfskrpalpegihrdievvtdmwgrpkvrlsgeiakhledvtihvslthedqta
aavaiieep

SCOPe Domain Coordinates for d3gwma_:

Click to download the PDB-style file with coordinates for d3gwma_.
(The format of our PDB-style files is described here.)

Timeline for d3gwma_: