Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (8 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [232344] (1 PDB entry) |
Domain d3gwma_: 3gwm A: [232345] automated match to d3nfde_ complexed with so4 |
PDB Entry: 3gwm (more details), 1.7 Å
SCOPe Domain Sequences for d3gwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gwma_ d.150.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} aivgvgidlvsipdfaeqvdrpgtvfaetftpgerrdaadksssaarhlaarwaakeavi kawsssrfskrpalpegihrdievvtdmwgrpkvrlsgeiakhledvtihvslthedqta aavaiieep
Timeline for d3gwma_: