SCOPe 2.06: Domain d3gvmd_: 3gvm D:

Lineage for d3gvmd_ (3gvm D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.3: EsxAB dimer-like [140453] (2 families)
   (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals

5. Family a.25.3.0: automated matches [193224] (1 protein)
   not a true family

6. Protein automated matches [193225] (4 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries)

8. Domain d3gvmd_: 3gvm D: [232340]
   Other proteins in same PDB: d3gvma2, d3gvmc2
   automated match to d4j7kb_

Details for d3gvmd_

PDB Entry: 3gvm, 2.15 Å

PDB Description: structure of the homodimeric wxg-100 family protein from streptococcus agalactiae

PDB Compounds: (D:) Putative uncharacterized protein SAG1039

SCOPe Domain Sequences for d3gvmd_:

Sequence; same for both SEQRES and ATOM records:

>d3gvmd_ a.25.3.0 (D:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki
tefaqlledinqqllkvadiieqtdadiasqisg

Timeline for d3gvmd_:

• d3gvmd_ first appeared in SCOPe 2.03
  
• d3gvmd_ appears in SCOPe 2.05
  
• d3gvmd_ appears in SCOPe 2.07
  
• d3gvmd_ appears in the current release, SCOPe 2.08