| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) ![]() (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals |
| Family a.25.3.0: automated matches [193224] (1 protein) not a true family |
| Protein automated matches [193225] (4 species) not a true protein |
| Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries) |
| Domain d3gvmb_: 3gvm B: [232338] Other proteins in same PDB: d3gvma2, d3gvmc2 automated match to d4j7kb_ |
PDB Entry: 3gvm (more details), 2.15 Å
SCOPe Domain Sequences for d3gvmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gvmb_ a.25.3.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki
tefaqlledinqqllkvadiieqtdadiasqisg
Timeline for d3gvmb_: