Lineage for d3gvmb_ (3gvm B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705332Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2705346Family a.25.3.0: automated matches [193224] (1 protein)
    not a true family
  6. 2705347Protein automated matches [193225] (4 species)
    not a true protein
  7. 2705388Species Streptococcus agalactiae [TaxId:208435] [232336] (2 PDB entries)
  8. 2705392Domain d3gvmb_: 3gvm B: [232338]
    Other proteins in same PDB: d3gvma2, d3gvmc2
    automated match to d4j7kb_

Details for d3gvmb_

PDB Entry: 3gvm (more details), 2.15 Å

PDB Description: structure of the homodimeric wxg-100 family protein from streptococcus agalactiae
PDB Compounds: (B:) Putative uncharacterized protein SAG1039

SCOPe Domain Sequences for d3gvmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvmb_ a.25.3.0 (B:) automated matches {Streptococcus agalactiae [TaxId: 208435]}
qikltpeelrssaqkytagsqqvtevlnlltqeqavidenwdgstfdsfeaqfnelspki
tefaqlledinqqllkvadiieqtdadiasqisg

SCOPe Domain Coordinates for d3gvmb_:

Click to download the PDB-style file with coordinates for d3gvmb_.
(The format of our PDB-style files is described here.)

Timeline for d3gvmb_: