Lineage for d3gvkc1 (3gvk C:246-760)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065368Family b.68.1.2: Endo-alpha-sialidase [117276] (2 protein domains)
    possibly related by the other family by circular permutation; includes extra N-terminal domain [dN: alpha/beta ] and insert domain [dI: beta-barrel, similar to the Reductase/isomerase/elongation factor common domain (50412)]
  6. 2065383Protein automated matches [232323] (1 species)
    not a true protein
  7. 2065384Species Enterobacteria phage [TaxId:344021] [232324] (4 PDB entries)
  8. 2065390Domain d3gvkc1: 3gvk C:246-760 [232332]
    Other proteins in same PDB: d3gvka2, d3gvkb2, d3gvkb3, d3gvkc2, d3gvkc3
    automated match to d1v0ea1
    complexed with na; mutant

Details for d3gvkc1

PDB Entry: 3gvk (more details), 1.84 Å

PDB Description: Crystal structure of endo-neuraminidase NF mutant
PDB Compounds: (C:) Endo-N-acetylneuraminidase

SCOPe Domain Sequences for d3gvkc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gvkc1 b.68.1.2 (C:246-760) automated matches {Enterobacteria phage [TaxId: 344021]}
akgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqply
yaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdragvsrlhvswvksgdd
gqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpmsr
slhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvl
tpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqgd
vaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlgs
slhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykasy
prtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhfn
pwtygdnsakdpfksdghpsdlycykmkigpdnrv

SCOPe Domain Coordinates for d3gvkc1:

Click to download the PDB-style file with coordinates for d3gvkc1.
(The format of our PDB-style files is described here.)

Timeline for d3gvkc1: