SCOPe 2.03: Domain d3gvja2: 3gvj A:761-910

Lineage for d3gvja2 (3gvj A:761-910)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
   (homo)trimer; each chain donates 3 beta-strands per turn of the helix

4. Superfamily b.108.1: Phage fibre proteins [69349] (6 families)

5. Family b.108.1.0: automated matches [231970] (1 protein)
   not a true family

6. Protein automated matches [231971] (3 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:344021] [232326] (3 PDB entries)

8. Domain d3gvja2: 3gvj A:761-910 [232327]
   Other proteins in same PDB: d3gvja1
   automated match to d1v0ea2
   mutant

Details for d3gvja2

PDB Entry: 3gvj, 1.48 Å

PDB Description: crystal structure of an endo-neuraminidasenf mutant

PDB Compounds: (A:) Endo-N-acetylneuraminidase

SCOPe Domain Sequences for d3gvja2:

Sequence; same for both SEQRES and ATOM records:

>d3gvja2 b.108.1.0 (A:761-910) automated matches {Enterobacteria phage [TaxId: 344021]}
srdfrygavpnravpvffdtngvrtvpapmeftgdlglghvtirastssnirsevlmege
ygfigksiptdnpagqriifcggegtssttgaqitlyganntdsrrivyngdehlfqsad
vkpyndnvtalggpsnrfttaylgsnpivt

Timeline for d3gvja2:

• d3gvja2 is new in SCOPe 2.03-stable
  
• d3gvja2 appears in SCOPe 2.04
  
• d3gvja2 appears in the current release, SCOPe 2.08