Lineage for d3gv7b2 (3gv7 B:300-414)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564907Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2564908Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2564909Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2564977Protein DNA polymerase iota [111015] (1 species)
  7. 2564978Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
    Uniprot Q9UNA4
  8. 2564979Domain d3gv7b2: 3gv7 B:300-414 [232318]
    Other proteins in same PDB: d3gv7b1
    automated match to d2dpia1
    protein/DNA complex; complexed with mg, ttp

Details for d3gv7b2

PDB Entry: 3gv7 (more details), 2.2 Å

PDB Description: Human DNA polymerase iota in complex with T template DNA and incoming dTTP
PDB Compounds: (B:) DNA polymerase iota

SCOPe Domain Sequences for d3gv7b2:

Sequence, based on SEQRES records: (download)

>d3gv7b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records): (download)

>d3gv7b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirrygresrqcpip
shviqkdvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

SCOPe Domain Coordinates for d3gv7b2:

Click to download the PDB-style file with coordinates for d3gv7b2.
(The format of our PDB-style files is described here.)

Timeline for d3gv7b2: