Lineage for d3gv5b2 (3gv5 B:300-414)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614248Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 2614249Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 2614250Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 2614318Protein DNA polymerase iota [111015] (1 species)
  7. 2614319Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
    Uniprot Q9UNA4
  8. 2614325Domain d3gv5b2: 3gv5 B:300-414 [232316]
    Other proteins in same PDB: d3gv5b1, d3gv5d1
    automated match to d2dpia1
    protein/DNA complex; complexed with adi, ca, gol

Details for d3gv5b2

PDB Entry: 3gv5 (more details), 2 Å

PDB Description: human dna polymerase iota in complex with t template dna and incoming ddadp
PDB Compounds: (B:) DNA polymerase iota

SCOPe Domain Sequences for d3gv5b2:

Sequence, based on SEQRES records: (download)

>d3gv5b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records): (download)

>d3gv5b2 d.240.1.1 (B:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirrysgresrqcpi
pshviqklnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

SCOPe Domain Coordinates for d3gv5b2:

Click to download the PDB-style file with coordinates for d3gv5b2.
(The format of our PDB-style files is described here.)

Timeline for d3gv5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gv5b1