Lineage for d3gpna2 (3gpn A:127-253)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583732Protein automated matches [227006] (3 species)
    not a true protein
  7. 2583740Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [232312] (4 PDB entries)
  8. 2583742Domain d3gpna2: 3gpn A:127-253 [232314]
    automated match to d1plqa2
    mutant

Details for d3gpna2

PDB Entry: 3gpn (more details), 2.5 Å

PDB Description: structure of the non-trimeric form of the e113g pcna mutant protein
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3gpna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpna2 d.131.1.2 (A:127-253) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapk

SCOPe Domain Coordinates for d3gpna2:

Click to download the PDB-style file with coordinates for d3gpna2.
(The format of our PDB-style files is described here.)

Timeline for d3gpna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpna1