SCOPe 2.08: Domain d3gpna2: 3gpn A:127-253

Lineage for d3gpna2 (3gpn A:127-253)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein automated matches [227006] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [232312] (4 PDB entries)

8. Domain d3gpna2: 3gpn A:127-253 [232314]
   automated match to d1plqa2
   mutant

Details for d3gpna2

PDB Entry: 3gpn, 2.5 Å

PDB Description: structure of the non-trimeric form of the e113g pcna mutant protein

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3gpna2:

Sequence; same for both SEQRES and ATOM records:

>d3gpna2 d.131.1.2 (A:127-253) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapk

Timeline for d3gpna2:

• d3gpna2 first appeared in SCOPe 2.03
  
• d3gpna2 appears in SCOPe 2.07