Lineage for d3gona1 (3gon A:1-194)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2500745Protein automated matches [232306] (1 species)
    not a true protein
  7. 2500746Species Streptococcus pneumoniae [TaxId:171101] [232307] (1 PDB entry)
  8. 2500747Domain d3gona1: 3gon A:1-194 [232308]
    Other proteins in same PDB: d3gona2
    automated match to d1k47a1
    complexed with anp, mg, pmv

Details for d3gona1

PDB Entry: 3gon (more details), 1.9 Å

PDB Description: Streptococcus pneumoniae Phosphomevalonate Kinase in Complex with Phosphomevalonate and AMPPNP
PDB Compounds: (A:) phosphomevalonate kinase

SCOPe Domain Sequences for d3gona1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gona1 d.14.1.5 (A:1-194) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlrpn
pdysliqetialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkalla
lynlsvdqnllfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenla
tvlerdwgfsisqv

SCOPe Domain Coordinates for d3gona1:

Click to download the PDB-style file with coordinates for d3gona1.
(The format of our PDB-style files is described here.)

Timeline for d3gona1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gona2