SCOPe 2.05: Domain d3gmpa2: 3gmp A:186-281

Lineage for d3gmpa2 (3gmp A:186-281)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3gmpa2: 3gmp A:186-281 [232304]
   Other proteins in same PDB: d3gmpa1, d3gmpb_
   automated match to d3hujc2
   complexed with edo, nag, pbs, plm

Details for d3gmpa2

PDB Entry: 3gmp, 1.7 Å

PDB Description: structure of mouse cd1d in complex with pbs-25

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmpa2:

Sequence, based on SEQRES records:

>d3gmpa2 b.1.1.0 (A:186-281) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywgs

Sequence, based on observed residues (ATOM records):

>d3gmpa2 b.1.1.0 (A:186-281) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilywgs

Timeline for d3gmpa2:

• d3gmpa2 first appeared in SCOPe 2.03
  
• d3gmpa2 appears in SCOPe 2.04
  
• d3gmpa2 appears in SCOPe 2.06
  
• d3gmpa2 appears in the current release, SCOPe 2.08