Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mus musculus [TaxId:10090] [227304] (35 PDB entries) |
Domain d3gmpa2: 3gmp A:186-281 [232304] Other proteins in same PDB: d3gmpa1, d3gmpb_ automated match to d3hujc2 complexed with edo, nag, pbs, plm |
PDB Entry: 3gmp (more details), 1.7 Å
SCOPe Domain Sequences for d3gmpa2:
Sequence, based on SEQRES records: (download)
>d3gmpa2 b.1.1.0 (A:186-281) automated matches {Mus musculus [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilywgs
>d3gmpa2 b.1.1.0 (A:186-281) automated matches {Mus musculus [TaxId: 10090]} qekpvawlsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld veageeaglacrvkhsslggqdiilywgs
Timeline for d3gmpa2: