| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (23 species) not a true protein |
| Species Mus musculus [TaxId:10090] [227304] (35 PDB entries) |
| Domain d3gmra2: 3gmr A:186-279 [232303] Other proteins in same PDB: d3gmra1, d3gmrb_ automated match to d3hujc2 complexed with c8p, edo, pg4, plm |
PDB Entry: 3gmr (more details), 1.9 Å
SCOPe Domain Sequences for d3gmra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmra2 b.1.1.0 (A:186-279) automated matches {Mus musculus [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d3gmra2: