SCOPe 2.07: Domain d3gmna2: 3gmn A:186-279

Lineage for d3gmna2 (3gmn A:186-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3gmna2: 3gmn A:186-279 [232300]
   Other proteins in same PDB: d3gmna1, d3gmna3, d3gmnb_
   automated match to d3hujc2
   complexed with bma, c1q, edo, fuc, man, nag, plm

Details for d3gmna2

PDB Entry: 3gmn, 1.7 Å

PDB Description: structure of mouse cd1d in complex with c10ph

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmna2:

Sequence, based on SEQRES records:

>d3gmna2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3gmna2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilyw

Timeline for d3gmna2:

• d3gmna2 first appeared in SCOPe 2.03
  
• d3gmna2 appears in SCOPe 2.06
  
• d3gmna2 appears in the current release, SCOPe 2.08