SCOPe 2.08: Domain d3gmma2: 3gmm A:186-279

Lineage for d3gmma2 (3gmm A:186-279)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3gmma2: 3gmm A:186-279 [232297]
   Other proteins in same PDB: d3gmma1, d3gmma3, d3gmmb_
   automated match to d3hujc2
   complexed with c8p, edo, nag, plm

Details for d3gmma2

PDB Entry: 3gmm, 1.8 Å

PDB Description: structure of mouse cd1d in complex with c8ph

PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmma2:

Sequence, based on SEQRES records:

>d3gmma2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3gmma2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilyw

Timeline for d3gmma2:

• d3gmma2 first appeared in SCOPe 2.03
  
• d3gmma2 appears in SCOPe 2.07