![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [54457] (18 PDB entries) |
![]() | Domain d3gmoa1: 3gmo A:7-185 [232296] Other proteins in same PDB: d3gmoa2, d3gmob_ automated match to d3hujc1 complexed with c8f, edo, nag, plm |
PDB Entry: 3gmo (more details), 1.6 Å
SCOPe Domain Sequences for d3gmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmoa1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3gmoa1: