Lineage for d3gmoa1 (3gmo A:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937606Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries)
  8. 2937607Domain d3gmoa1: 3gmo A:7-185 [232296]
    Other proteins in same PDB: d3gmoa2, d3gmoa3, d3gmob_
    automated match to d3hujc1
    complexed with c8f, edo, nag, plm

Details for d3gmoa1

PDB Entry: 3gmo (more details), 1.6 Å

PDB Description: structure of mouse cd1d in complex with c8phf
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3gmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gmoa1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3gmoa1:

Click to download the PDB-style file with coordinates for d3gmoa1.
(The format of our PDB-style files is described here.)

Timeline for d3gmoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d3gmob_