| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
| Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) |
| Domain d3gmla1: 3gml A:7-185 [232292] Other proteins in same PDB: d3gmla2, d3gmla3, d3gmlb_ automated match to d3hujc1 complexed with c6q, edo, nag, plm |
PDB Entry: 3gml (more details), 1.7 Å
SCOPe Domain Sequences for d3gmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gmla1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3gmla1: