SCOPe 2.03: Domain d3gl3c_: 3gl3 C:

Lineage for d3gl3c_ (3gl3 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Chlorobium tepidum [TaxId:194439] [232284] (1 PDB entry)

8. Domain d3gl3c_: 3gl3 C: [232287]
   automated match to d4nmub_

Details for d3gl3c_

PDB Entry: 3gl3, 2.09 Å

PDB Description: crystal structure of a putative thiol:disulfide interchange protein dsbe from chlorobium tepidum

PDB Compounds: (C:) Putative Thiol:disulfide interchange protein DsbE

SCOPe Domain Sequences for d3gl3c_:

Sequence; same for both SEQRES and ATOM records:

>d3gl3c_ c.47.1.0 (C:) automated matches {Chlorobium tepidum [TaxId: 194439]}
dkgdkapdfalpgktgvvklsdktgsvvyldfwaswcgpcrqsfpwmnqmqakykakgfq
vvavnldaktgdamkflaqvpaeftvafdpkgqtprlygvkgmptsflidrngkvllqhv
gfrpadkealeqqilaal

Timeline for d3gl3c_:

• d3gl3c_ is new in SCOPe 2.03-stable
  
• d3gl3c_ appears in SCOPe 2.04
  
• d3gl3c_ appears in the current release, SCOPe 2.08