| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Chlorobium tepidum [TaxId:194439] [232284] (1 PDB entry) |
| Domain d3gl3b1: 3gl3 B:30-169 [232285] Other proteins in same PDB: d3gl3a2, d3gl3b2 automated match to d4nmub_ |
PDB Entry: 3gl3 (more details), 2.09 Å
SCOPe Domain Sequences for d3gl3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gl3b1 c.47.1.0 (B:30-169) automated matches {Chlorobium tepidum [TaxId: 194439]}
dkgdkapdfalpgktgvvklsdktgsvvyldfwaswcgpcrqsfpwmnqmqakykakgfq
vvavnldaktgdamkflaqvpaeftvafdpkgqtprlygvkgmptsflidrngkvllqhv
gfrpadkealeqqilaalgg
Timeline for d3gl3b1:
View in 3DDomains from other chains: (mouse over for more information) d3gl3a1, d3gl3a2, d3gl3c_, d3gl3d_ |