Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (21 species) not a true protein |
Species Nocardioides aromaticivorans [TaxId:200618] [232264] (1 PDB entry) |
Domain d3gcfc2: 3gcf C:149-382 [232278] Other proteins in same PDB: d3gcfa1, d3gcfb1, d3gcfc1, d3gcfd1, d3gcfe1, d3gcff1, d3gcfg1, d3gcfh1, d3gcfi1, d3gcfj1, d3gcfk1, d3gcfl1, d3gcfm1, d3gcfn1, d3gcfo1 automated match to d2de6a2 complexed with cl, fe2, fes |
PDB Entry: 3gcf (more details), 2.3 Å
SCOPe Domain Sequences for d3gcfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gcfc2 d.129.3.0 (C:149-382) automated matches {Nocardioides aromaticivorans [TaxId: 200618]} halsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrnspwvsgnrlafpy gfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsaeltgeekkvaaqvsv wlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvktfevefeerwrdd alhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlasergrgvra
Timeline for d3gcfc2:
View in 3D Domains from other chains: (mouse over for more information) d3gcfa1, d3gcfa2, d3gcfb1, d3gcfb2, d3gcfd1, d3gcfd2, d3gcfe1, d3gcfe2, d3gcff1, d3gcff2, d3gcfg1, d3gcfg2, d3gcfh1, d3gcfh2, d3gcfi1, d3gcfi2, d3gcfj1, d3gcfj2, d3gcfk1, d3gcfk2, d3gcfl1, d3gcfl2, d3gcfm1, d3gcfm2, d3gcfn1, d3gcfn2, d3gcfo1, d3gcfo2 |