Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (13 species) not a true protein |
Species Nocardioides aromaticivorans [TaxId:200618] [232264] (1 PDB entry) |
Domain d3gcfb2: 3gcf B:149-382 [232277] Other proteins in same PDB: d3gcfa1, d3gcfb1, d3gcfc1 automated match to d2de6a2 complexed with cl, fe2, fes |
PDB Entry: 3gcf (more details), 2.3 Å
SCOPe Domain Sequences for d3gcfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gcfb2 d.129.3.0 (B:149-382) automated matches {Nocardioides aromaticivorans [TaxId: 200618]} halsedlppgfldedthllgirrtvqsnwrlgvengfdtthifmhrnspwvsgnrlafpy gfvpadrdamqvydenwpkgvldrlsenympvfeatldgetvlsaeltgeekkvaaqvsv wlpgvlkvdpfpdptliqyefyvpisetqheyfqvlqrkvegpedvktfevefeerwrdd alhgfndddvwareaqqefygerdgwskeqlfppdmcivkwrtlasergrgvra
Timeline for d3gcfb2:
View in 3D Domains from other chains: (mouse over for more information) d3gcfa1, d3gcfa2, d3gcfc1, d3gcfc2 |