Lineage for d3gbrb2 (3gbr B:71-344)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106674Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106675Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families) (S)
    automatically mapped to Pfam PF00591
  5. 2106676Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 protein domains)
  6. 2106677Protein Anthranilate phosphoribosyltransferase (TrpD) [82364] (3 species)
  7. 2106685Species Sulfolobus solfataricus [TaxId:2287] [82365] (7 PDB entries)
  8. 2106695Domain d3gbrb2: 3gbr B:71-344 [232265]
    Other proteins in same PDB: d3gbra1, d3gbrb1
    automated match to d1o17a2
    complexed with gol, mn, peg, prp; mutant

Details for d3gbrb2

PDB Entry: 3gbr (more details), 2.25 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. solfataricus
PDB Compounds: (B:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d3gbrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbrb2 c.27.1.1 (B:71-344) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
vpnaidtagtgggglgtvnvstasaillslvnpvakhgnravsgksgsadvlealgynii
vpperakelvnktnfvflsaqyyhpamknvanvrktlgirtifnilgpltnpanakyqlm
gvfskdhldllsksayeldfnkiilvygepgidevspigntfmkivskrgieevklnvtd
fgispipieklivnsaedsaikivraflgkdehvaefikintavalfaldrvgdfregye
yadhlieksldklneiismngdvtklktivvkss

SCOPe Domain Coordinates for d3gbrb2:

Click to download the PDB-style file with coordinates for d3gbrb2.
(The format of our PDB-style files is described here.)

Timeline for d3gbrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gbrb1