SCOPe 2.08: Domain d3g9wa1: 3g9w A:198-311

Lineage for d3g9wa1 (3g9w A:198-311)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein automated matches [232256] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [232257] (1 PDB entry)

8. Domain d3g9wa1: 3g9w A:198-311 [232263]
   Other proteins in same PDB: d3g9wa2, d3g9wa3, d3g9wb2
   automated match to d1mixa1
   complexed with gol, peg

Details for d3g9wa1

PDB Entry: 3g9w, 2.17 Å

PDB Description: Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail

PDB Compounds: (A:) Talin-2

SCOPe Domain Sequences for d3g9wa1:

Sequence; same for both SEQRES and ATOM records:

>d3g9wa1 a.11.2.1 (A:198-311) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kffysdqnvdsrdpvqlnllyvqarddilngshpvsfekacefggfqaqiqfgphvehkh
kpgfldlkeflpkeyikqrgaekrifqehkncgemseieakvkyvklarslrty

Timeline for d3g9wa1:

• d3g9wa1 first appeared in SCOPe 2.03
  
• d3g9wa1 appears in SCOPe 2.07