Lineage for d3gc3a1 (3gc3 A:5-175)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039281Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 2039282Protein Arrestin [49244] (3 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 2039283Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries)
  8. 2039288Domain d3gc3a1: 3gc3 A:5-175 [232261]
    Other proteins in same PDB: d3gc3b1, d3gc3b2
    automated match to d1g4ma1

Details for d3gc3a1

PDB Entry: 3gc3 (more details), 2.2 Å

PDB Description: crystal structure of arrestin2s and clathrin
PDB Compounds: (A:) beta-arrestin-1

SCOPe Domain Sequences for d3gc3a1:

Sequence, based on SEQRES records: (download)

>d3gc3a1 b.1.18.11 (A:5-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg
redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

Sequence, based on observed residues (ATOM records): (download)

>d3gc3a1 b.1.18.11 (A:5-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvrrvyvtltcafryggltfrkd
lfvanvqsfppkpltrlqerlikklgehaypftfeippnlpcsvtlqacgvdyevkafca
enleekihkrnsvrlvirkvqyap

SCOPe Domain Coordinates for d3gc3a1:

Click to download the PDB-style file with coordinates for d3gc3a1.
(The format of our PDB-style files is described here.)

Timeline for d3gc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gc3a2