SCOPe 2.07: Domain d3gbra1: 3gbr A:1-70

Lineage for d3gbra1 (3gbr A:1-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries)

8. Domain d3gbra1: 3gbr A:1-70 [232260]
   Other proteins in same PDB: d3gbra2, d3gbrb2
   automated match to d1o17a1
   complexed with gol, mn, peg, prp; mutant

Details for d3gbra1

PDB Entry: 3gbr, 2.25 Å

PDB Description: anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. solfataricus

PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d3gbra1:

Sequence; same for both SEQRES and ATOM records:

>d3gbra1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d3gbra1:

• d3gbra1 first appeared in SCOPe 2.03
  
• d3gbra1 appears in SCOPe 2.06
  
• d3gbra1 appears in the current release, SCOPe 2.08