Class a: All alpha proteins [46456] (289 folds) |
Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) automatically mapped to Pfam PF02885 |
Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries) |
Domain d3gbra1: 3gbr A:1-70 [232260] Other proteins in same PDB: d3gbra2, d3gbrb2 automated match to d1o17a1 complexed with gol, mn, peg, prp; mutant |
PDB Entry: 3gbr (more details), 2.25 Å
SCOPe Domain Sequences for d3gbra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbra1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]} mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar amrelaikid
Timeline for d3gbra1: