Lineage for d3g9wb1 (3g9w B:205-311)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697541Protein automated matches [232256] (1 species)
    not a true protein
  7. 2697542Species Mouse (Mus musculus) [TaxId:10090] [232257] (1 PDB entry)
  8. 2697544Domain d3g9wb1: 3g9w B:205-311 [232258]
    Other proteins in same PDB: d3g9wa2, d3g9wa3, d3g9wb2
    automated match to d1mixa1
    complexed with gol, peg

Details for d3g9wb1

PDB Entry: 3g9w (more details), 2.17 Å

PDB Description: Crystal Structure of Talin2 F2-F3 in Complex with the Integrin Beta1D Cytoplasmic Tail
PDB Compounds: (B:) Talin-2

SCOPe Domain Sequences for d3g9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g9wb1 a.11.2.1 (B:205-311) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nvdsrdpvqlnllyvqarddilngshpvsfekacefggfqaqiqfgphvehkhkpgfldl
keflpkeyikqrgaekrifqehkncgemseieakvkyvklarslrty

SCOPe Domain Coordinates for d3g9wb1:

Click to download the PDB-style file with coordinates for d3g9wb1.
(The format of our PDB-style files is described here.)

Timeline for d3g9wb1: