Lineage for d3g7na_ (3g7n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136490Species Penicillium expansum [TaxId:27334] [232252] (1 PDB entry)
  8. 2136491Domain d3g7na_: 3g7n A: [232253]
    automated match to d1tiba_
    complexed with 1pe, peg, so4

Details for d3g7na_

PDB Entry: 3g7n (more details), 1.3 Å

PDB Description: crystal structure of a triacylglycerol lipase from penicillium expansum at 1.3
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d3g7na_:

Sequence, based on SEQRES records: (download)

>d3g7na_ c.69.1.0 (A:) automated matches {Penicillium expansum [TaxId: 27334]}
atadaaafpdlhraaklssaaytgcigkafdvtivkriydlvtdtngfvgystekktiav
imrgsttitdfvndidialitpelsgvtfpsdvkimrgvhrpwsavhdtiitevkaliak
ypdytleavghslggaltsiahvalaqnfpdkslvsnalnafpignqawadfgtaqagtf
nrgnnvldgvpnmyssplvnfkhygteyyssgteastvkcegqrdkscsagngmyavtpg
hiasfgvvmltagcgyls

Sequence, based on observed residues (ATOM records): (download)

>d3g7na_ c.69.1.0 (A:) automated matches {Penicillium expansum [TaxId: 27334]}
atadaaafpdlhraaklssaaytgcigkafdvtivkriydlvtdtngfvgystekktiav
imrgsttitdidialitpelsgvtfpsdvkimrgvhrpwsavhdtiitevkaliakypdy
tleavghslggaltsiahvalaqnfpdkslvsnalnafpignqawadfgtaqagtfnrgn
nvldgvpnmyssplvnfkhygteyyssgteastvkcegqrdkscsagngmyavtpghias
fgvvmltagcgyls

SCOPe Domain Coordinates for d3g7na_:

Click to download the PDB-style file with coordinates for d3g7na_.
(The format of our PDB-style files is described here.)

Timeline for d3g7na_: