SCOPe 2.05: Domain d3g7fh1: 3g7f H:1-36

Lineage for d3g7fh1 (3g7f H:1-36)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.0: automated matches [227192] (1 protein)
   not a true family

6. Protein automated matches [226917] (3 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [232250] (4 PDB entries)

8. Domain d3g7fh1: 3g7f H:1-36 [232251]
   Other proteins in same PDB: d3g7fc_, d3g7fh2, d3g7fl_, d3g7fm_
   automated match to d1dxrh2
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, uq1; mutant

Details for d3g7fh1

PDB Entry: 3g7f, 2.5 Å

PDB Description: Crystal structure of Blastochloris viridis heterodimer mutant reaction center

PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d3g7fh1:

Sequence; same for both SEQRES and ATOM records:

>d3g7fh1 f.23.10.0 (H:1-36) automated matches {Blastochloris viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d3g7fh1:

• d3g7fh1 first appeared in SCOPe 2.03
  
• d3g7fh1 appears in SCOPe 2.04
  
• d3g7fh1 appears in SCOPe 2.06
  
• d3g7fh1 appears in the current release, SCOPe 2.08