Lineage for d1d0ac1 (1d0a C:350-501)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304360Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304361Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1304362Family b.8.1.1: MATH domain [49600] (4 proteins)
    automatically mapped to Pfam PF00917
  6. 1304378Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species)
  7. 1304379Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries)
  8. 1304399Domain d1d0ac1: 1d0a C:350-501 [23225]
    Other proteins in same PDB: d1d0aa2, d1d0ab2, d1d0ac2, d1d0ad2, d1d0ae2, d1d0af2

Details for d1d0ac1

PDB Entry: 1d0a (more details), 2 Å

PDB Description: structure of tnf receptor associated factor 2 (traf2) in complex with a human ox40 peptide
PDB Compounds: (C:) tumor necrosis factor receptor associated protein 2

SCOPe Domain Sequences for d1d0ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ac1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]}
ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl
ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc
plfcpvskmeaknsyvrddaifikaivdltgl

SCOPe Domain Coordinates for d1d0ac1:

Click to download the PDB-style file with coordinates for d1d0ac1.
(The format of our PDB-style files is described here.)

Timeline for d1d0ac1: