Class b: All beta proteins [48724] (144 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (2 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.1: TRAF domain [49600] (3 proteins) |
Protein TNF receptor associated factor 2 (TRAF2) [49601] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49602] (10 PDB entries) |
Domain d1d0ac1: 1d0a C:350-501 [23225] Other proteins in same PDB: d1d0aa2, d1d0ab2, d1d0ac2, d1d0ad2, d1d0ae2, d1d0af2 |
PDB Entry: 1d0a (more details), 2 Å
SCOP Domain Sequences for d1d0ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ac1 b.8.1.1 (C:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens)} ydgvfiwkisdfprkrqeavagripaifspafytsrygykmclriylngdgtgrgthlsl ffvvmkgpndallrwpfnqkvtlmlldqnnrehvidafrpdvtsssfqrpvndmniasgc plfcpvskmeaknsyvrddaifikaivdltgl
Timeline for d1d0ac1: