SCOPe 2.08: Domain d3g75a_: 3g75 A:

Lineage for d3g75a_ (3g75 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d3g75a_: 3g75 A: [232249]
   automated match to d4gfna_
   complexed with b48

Details for d3g75a_

PDB Entry: 3g75, 2.3 Å

PDB Description: crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d3g75a_:

Sequence; same for both SEQRES and ATOM records:

>d3g75a_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

Timeline for d3g75a_:

• d3g75a_ first appeared in SCOPe 2.03
  
• d3g75a_ appears in SCOPe 2.07