SCOPe 2.03: Domain d3g75b_: 3g75 B:

Lineage for d3g75b_ (3g75 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (10 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (2 PDB entries)

8. Domain d3g75b_: 3g75 B: [232248]
   automated match to d4gfna_
   complexed with b48

Details for d3g75b_

PDB Entry: 3g75, 2.3 Å

PDB Description: crystal structure of staphylococcus aureus gyrase b co-complexed with 4-methyl-5-[3-(methylsulfanyl)-1h-pyrazol-5-yl]-2-thiophen-2-yl-1,3-thiazole inhibitor

PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d3g75b_:

Sequence; same for both SEQRES and ATOM records:

>d3g75b_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng
rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg
ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds
yhye

Timeline for d3g75b_:

• d3g75b_ is new in SCOPe 2.03-stable
  
• d3g75b_ appears in SCOPe 2.04
  
• d3g75b_ appears in the current release, SCOPe 2.08