![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (22 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries) |
![]() | Domain d3g75b_: 3g75 B: [232248] automated match to d4gfna_ complexed with b48 |
PDB Entry: 3g75 (more details), 2.3 Å
SCOPe Domain Sequences for d3g75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g75b_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]} gleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdng rgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlkevg ttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvreds yhye
Timeline for d3g75b_: