Lineage for d3g4lc_ (3g4l C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018901Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2018902Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2018992Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2019055Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2019056Species Human (Homo sapiens) [TaxId:9606] [89152] (39 PDB entries)
    Uniprot Q08499 388-713
  8. 2019136Domain d3g4lc_: 3g4l C: [232241]
    automated match to d3g4id_
    complexed with edo, mg, rof, so4, zn

Details for d3g4lc_

PDB Entry: 3g4l (more details), 2.5 Å

PDB Description: crystal structure of human phosphodiesterase 4d with roflumilast
PDB Compounds: (C:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3g4lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g4lc_ a.211.1.2 (C:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d3g4lc_:

Click to download the PDB-style file with coordinates for d3g4lc_.
(The format of our PDB-style files is described here.)

Timeline for d3g4lc_: