SCOPe 2.07: Domain d3g4lb_: 3g4l B:

Lineage for d3g4lb_ (3g4l B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3g4lb_: 3g4l B: [232240]
   automated match to d3g4id_
   complexed with edo, mg, rof, so4, zn

Details for d3g4lb_

PDB Entry: 3g4l, 2.5 Å

PDB Description: crystal structure of human phosphodiesterase 4d with roflumilast

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3g4lb_:

Sequence; same for both SEQRES and ATOM records:

>d3g4lb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
lvhpdaqdildtlednrewyqstipq

Timeline for d3g4lb_:

• d3g4lb_ first appeared in SCOPe 2.03
  
• d3g4lb_ appears in SCOPe 2.06
  
• d3g4lb_ appears in the current release, SCOPe 2.08