Lineage for d3g3ba_ (3g3b A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834683Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1834752Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1834946Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1834947Protein automated matches [190787] (10 species)
    not a true protein
  7. 1834998Species Sea lamprey (Petromyzon marinus) [TaxId:7757] [231246] (5 PDB entries)
  8. 1835011Domain d3g3ba_: 3g3b A: [232236]
    Other proteins in same PDB: d3g3bb_, d3g3bd_, d3g3bf_, d3g3bh_
    automated match to d2o6ra_
    mutant

Details for d3g3ba_

PDB Entry: 3g3b (more details), 2.4 Å

PDB Description: Structure of a lamprey variable lymphocyte receptor mutant in complex with a protein antigen
PDB Compounds: (A:) variable lymphocyte receptor VLRB.2D

SCOPe Domain Sequences for d3g3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g3ba_ c.10.2.0 (A:) automated matches {Sea lamprey (Petromyzon marinus) [TaxId: 7757]}
acpsqcscsgttvdcsgkslasvptgiptttqvlylydnritklepgvfdrltqltrldl
dnnqltvlpagvfdkltqltqlslndnqlksiprgafdnlrslthiwllnnpwdcacsdi
lylsrwisqhpwlvfgylnldhdsarcsgtntpvravtkastspskcpg

SCOPe Domain Coordinates for d3g3ba_:

Click to download the PDB-style file with coordinates for d3g3ba_.
(The format of our PDB-style files is described here.)

Timeline for d3g3ba_: