SCOPe 2.08: Domain d3g1oa2: 3g1o A:95-215

Lineage for d3g1oa2 (3g1o A:95-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein automated matches [226970] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232226] (7 PDB entries)

8. Domain d3g1oa2: 3g1o A:95-215 [232231]
   Other proteins in same PDB: d3g1oa1
   automated match to d1t56a2
   protein/DNA complex; complexed with rf1

Details for d3g1oa2

PDB Entry: 3g1o, 1.85 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14500

PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3g1oa2:

Sequence; same for both SEQRES and ATOM records:

>d3g1oa2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

Timeline for d3g1oa2:

• d3g1oa2 first appeared in SCOPe 2.03
  
• d3g1oa2 appears in SCOPe 2.07