Lineage for d3g1oa1 (3g1o A:22-94)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982558Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)
  8. 1982571Domain d3g1oa1: 3g1o A:22-94 [232230]
    Other proteins in same PDB: d3g1oa2
    automated match to d1t56a1
    protein/DNA complex; complexed with rf1

Details for d3g1oa1

PDB Entry: 3g1o (more details), 1.85 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14500
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3g1oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g1oa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d3g1oa1:

Click to download the PDB-style file with coordinates for d3g1oa1.
(The format of our PDB-style files is described here.)

Timeline for d3g1oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g1oa2