| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein automated matches [226970] (3 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [232226] (8 PDB entries) |
| Domain d3g1la2: 3g1l A:95-215 [232228] Other proteins in same PDB: d3g1la1 automated match to d1t56a2 protein/DNA complex; complexed with rf2 |
PDB Entry: 3g1l (more details), 1.7 Å
SCOPe Domain Sequences for d3g1la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1la2 a.121.1.1 (A:95-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n
Timeline for d3g1la2: