Lineage for d3g1la1 (3g1l A:22-94)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258653Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1258654Protein automated matches [190674] (11 species)
    not a true protein
  7. 1258680Species Mycobacterium tuberculosis [TaxId:1773] [232223] (4 PDB entries)
  8. 1258682Domain d3g1la1: 3g1l A:22-94 [232224]
    Other proteins in same PDB: d3g1la2
    automated match to d1t56a1
    protein/DNA complex; complexed with rf2

Details for d3g1la1

PDB Entry: 3g1l (more details), 1.7 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM14744
PDB Compounds: (A:) transcriptional regulatory repressor protein (tetr-family) ethr

SCOPe Domain Sequences for d3g1la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g1la1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d3g1la1:

Click to download the PDB-style file with coordinates for d3g1la1.
(The format of our PDB-style files is described here.)

Timeline for d3g1la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g1la2