SCOPe 2.05: Domain d3g0oa2: 3g0o A:170-292

Lineage for d3g0oa2 (3g0o A:170-292)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (30 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [232221] (1 PDB entry)

8. Domain d3g0oa2: 3g0o A:170-292 [232222]
   Other proteins in same PDB: d3g0oa1
   automated match to d1vpda1
   complexed with cl, tla

Details for d3g0oa2

PDB Entry: 3g0o, 1.8 Å

PDB Description: crystal structure of 3-hydroxyisobutyrate dehydrogenase (ygbj) from salmonella typhimurium

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3g0oa2:

Sequence; same for both SEQRES and ATOM records:

>d3g0oa2 a.100.1.0 (A:170-292) automated matches {Salmonella typhimurium [TaxId: 602]}
tpgagstvkiihqllagvhiaaaaeamalaaragipldvmydvvthaagnswmfenrmqh
vvdgdytprsavdifvkdlglvadtakalrfplplastalnmftsasnagygkeddsavi
kif

Timeline for d3g0oa2:

• d3g0oa2 first appeared in SCOPe 2.03
  
• d3g0oa2 appears in SCOPe 2.04
  
• d3g0oa2 appears in SCOPe 2.06
  
• d3g0oa2 appears in the current release, SCOPe 2.08