![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:602] [232221] (1 PDB entry) |
![]() | Domain d3g0oa2: 3g0o A:170-292 [232222] Other proteins in same PDB: d3g0oa1 automated match to d1vpda1 complexed with cl, tla |
PDB Entry: 3g0o (more details), 1.8 Å
SCOPe Domain Sequences for d3g0oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g0oa2 a.100.1.0 (A:170-292) automated matches {Salmonella typhimurium [TaxId: 602]} tpgagstvkiihqllagvhiaaaaeamalaaragipldvmydvvthaagnswmfenrmqh vvdgdytprsavdifvkdlglvadtakalrfplplastalnmftsasnagygkeddsavi kif
Timeline for d3g0oa2: