Lineage for d3g0oa2 (3g0o A:170-292)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721934Species Salmonella typhimurium [TaxId:602] [232221] (1 PDB entry)
  8. 2721935Domain d3g0oa2: 3g0o A:170-292 [232222]
    Other proteins in same PDB: d3g0oa1
    automated match to d1vpda1
    complexed with cl, tla

Details for d3g0oa2

PDB Entry: 3g0o (more details), 1.8 Å

PDB Description: crystal structure of 3-hydroxyisobutyrate dehydrogenase (ygbj) from salmonella typhimurium
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d3g0oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0oa2 a.100.1.0 (A:170-292) automated matches {Salmonella typhimurium [TaxId: 602]}
tpgagstvkiihqllagvhiaaaaeamalaaragipldvmydvvthaagnswmfenrmqh
vvdgdytprsavdifvkdlglvadtakalrfplplastalnmftsasnagygkeddsavi
kif

SCOPe Domain Coordinates for d3g0oa2:

Click to download the PDB-style file with coordinates for d3g0oa2.
(The format of our PDB-style files is described here.)

Timeline for d3g0oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g0oa1