Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
Protein Cytochrome c oxidase [49544] (4 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [74870] (7 PDB entries) |
Domain d3fyeb2: 3fye B:130-281 [232211] Other proteins in same PDB: d3fyea_, d3fyeb1, d3fyeb3, d3fyec_, d3fyed1, d3fyed3 automated match to d1m56b1 complexed with ca, cd, cu1, dmu, hea, hto, mg, trd, unx |
PDB Entry: 3fye (more details), 2.15 Å
SCOPe Domain Sequences for d3fyeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyeb2 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff gqcselcgishaympitvkvvseeayaawleq
Timeline for d3fyeb2: